137043
entries available
on 2018-1-17
00:00 UTC / 09:00 JST
Summary Structural Experimental Function Sequence Neighbor History Download Link

Mine: 3aixCrystal structure of PCNA2-PCNA3 complex from Sulfolobus tokodaii (I222)

Please select an entity.

>3aix A DNA polymerase sliding clamp C Entity#:1
MRVKVIDADAFSYIFRTLEEFIDEITLDFTSDGLKIRGIDPSRVTFIDILIPAGYFEEYNVEKEEKVGVKLEDFTDVLKT VTKNDSLYLETDENQNIKVTLDGVYERTFTFPSIVASEIETPNLNLEFPFKAKALTVTFTDIIDEIEDIGGDSITFKAEG GKLYLSANSDMGSSTIELSTENGGLLESEGGDAESVYGLEYVVNTSKMRKPSDTVEIAFGSQIPLKLRYNLPQGGYADFY IAPRAE

>3aix B DNA polymerase sliding clamp B Entity#:2
MIKATYSSAKDFYSLLSGLLKVTDEIILNFTEDSIFSRYLTDDKVLMVIFKIPKEYLEDYTIDKPLGIKININDLKKILG KAKSKSATVTLEETEAGLKVTVRDEKTGTRSNIYIKGEKTSIDQLTEPKVNLSVTFTTDGDVLKDIARDLSLVGEEVEIS ADENTVTLSTEEAGRTYKSLLKQDKPLKSLNVESPSKAVYSIEVLKDVFKVTSISQNVTVGFGNNIPMKIEVPTDSGGQL IFWIAPRL

        


Copyright © 2007 Protein Data Bank Japan