137043
entries available
on 2018-1-17
00:00 UTC / 09:00 JST
Summary Structural Experimental Function Sequence Neighbor History Download Link

Mine: 3aizCrystal structure of PCNA2-PCNA3 complex from Sulfolobus tokodaii (P21212)

Please select an entity.

>3aiz A,B DNA polymerase sliding clamp B Entity#:1
MIKATYSSAKDFYSLLSGLLKVTDEIILNFTEDSIFSRYLTDDKVLMVIFKIPKEYLEDYTIDKPLGIKININDLKKILG KAKSKSATVTLEETEAGLKVTVRDEKTGTRSNIYIKGEKTSIDQLTEPKVNLSVTFTTDGDVLKDIARDLSLVGEEVEIS ADENTVTLSTEEAGRTYKSLLKQDKPLKSLNVESPSKAVYSIEVLKDVFKVTSISQNVTVGFGNNIPMKIEVPTDSGGQL IFWIAPRL

>3aiz C,D DNA polymerase sliding clamp C Entity#:2
MRVKVIDADAFSYIFRTLEEFIDEITLDFTSDGLKIRGIDPSRVTFIDILIPAGYFEEYNVEKEEKVGVKLEDFTDVLKT VTKNDSLYLETDENQNIKVTLDGVYERTFTFPSIVASEIETPNLNLEFPFKAKALTVTFTDIIDEIEDIGGDSITFKAEG GKLYLSANSDMGSSTIELSTENGGLLESEGGDAESVYGLEYVVNTSKMRKPSDTVEIAFGSQIPLKLRYNLPQGGYADFY IAPRAE

        


Copyright © 2007 Protein Data Bank Japan